GPM10100152982: ENSP00000262623

| model | homologues | context | group | gel | chip | peptide | table | details | GO |
| BTO | path | ppi | doms | snaps | mh | XML | wiki |

| ensembl | ncbi | pubmed | omim | hprd | unigene | snps | geo |
hpa |
| kegg | hmdb | grid | string | p-site | pep-atlas | mrm | gpmDB | wiki | pSYT | SNAP |
Sample information
Show:
 (n) (ω) Display as: Show/hide: save | clear 
 ENSP00000262623:
log(e) = -103.1 		 ATPase, H+/K+ exchanging, alpha polypeptide
    [Source: HGNC 819]
    IPR008250 ATPase P-typ ATPase-assoc-dom
    IPR000695 ATPase P-typ H-transp
    IPR015127 ATPase P-typ H/K-transp N
    IPR018303 ATPase P-typ P site
    IPR005775 ATPase P-typ cation-ex asu euk
    IPR006069 ATPase P-typ cation-exchng asu
    IPR006068 ATPase P-typ cation-transptr C
    IPR004014 ATPase P-typ cation-transptr N
    IPR001757 ATPase P-typ ion-transptr
    IPR005834 Dehalogen-like hydro
     (validate)
(mrm)
 1  mgkaenyelysvelgpgpggdmaakmskkkkagggggkrkeklenmkkemeindhqlsva
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA		  60
 61  eleqkyqtsatkglsaslaaelllrdgpnalrpprgtpeyvkrarqlagglqclmwvaaa
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA		  120
 121  icliafaiqasegdlttddnlylaraliavvvvtgcfgyyqefkstniiasfknlvpqqa
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA		  180
 181  tvirdgdkfqinadqlvvgdlvemkggdrvpadirilaaqgckvdnssltgesepytrsp
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP		  240
 241  ecthespletrniaffstmclegtrqglvvntgdrtiigriaslasgvenektpiaieie
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE		  300
 301  hfvdiiaglailfgatffivamcigytflramvffmaivvayvpegllatvtvclsltak
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK		  360
 361  rlaskncvvknleavetlgstsvicsdktgtltqnrmtvshmwfdnhihtadttedqsgq
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ		  420
 421  tfdqssetwralcrvltlcnraafksgqdavpvpkrivigdasetallkfseltlgnamg
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG		  480
 481  yrdrfpkvceipfnstnkfqlskhtledprdprhllvmkgapervlercssilikgqelp
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP		  540
 541  ldeqwreafqtaylslgglgervlgfcqlylnekdyppgyafdvesmnfpssglcfaglv
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV		  600
 601  smidppratvpdavlkcrtagirvimvtgdhpitakaiaasvgiisegsetvediaarlr
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR		  660
 661  vpvdqvnrkdaracvingmwlkdmdpselvealrthpemvfartspqqklvivescqrlg
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG		  720
 721  aivavtgdgvndspalkkadigvamgiagsdaaknaadmillddnfasivtgveqgrlif
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF		  780
 781  dnlkksiaytltknipeltpyliyitvsvplplgcitilfielctdifpsvslayekaes
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES		  840
 841  dimhlrprnpkrdrlvneplaaysyfqigaiqsfagftdyftamaqegwfpllcvglraq
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ		  900
 901  wedhhlqdlqdsygqewtfgqrlyqqytcytvffisievcqiadvlirktrrlsafqqgf
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF		  960
 961  frnkilviaivfqvcigcflcycpgmpyifnfmpirfqwwlvplpygilifvydeirklg
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG		  1020
 1021  vrccpgswwdqelyy
VRCCPGSWWDQELYY		  1035

 Identified Peptides

spectrumlog(e)log(I)m+hdeltaz sequencen
8469.1-9.82.811548.7360.9722nyel10YSVELGPGPG GDMAAK  25mskk()
8839.1-2.52.62980.5410.5512qefk165STNIIASFK  173nlvp()
6445.1-4.62.751619.7510.8312qgck224VDNSSLTGES EPQTR  238spec()
6651.1-4.22.911619.7510.5692qgck224VDNSSLTGES EPQTR  238spec()
6518.1-2.32.851619.7510.4232qgck224VDNSSLTGES EPQTR  238spec()
7799.1-5.12.951217.6370.8422iigr281IASLASGVEN EK  292tpia()
7727.1-4.02.931217.6370.1402iigr281IASLASGVEN EK  292tpia()
7659.1-4.02.821217.6370.6622iigr281IASLASGVEN EK  292tpia()
7527.1-3.42.971217.6371.2142iigr281IASLASGVEN EK  292tpia()
7462.1-3.22.871217.6371.5942iigr281IASLASGVEN EK  292tpia()
7593.1-3.22.971217.6370.8812iigr281IASLASGVEN EK  292tpia()
9310.1-5.73.131922.9375-0.00662cvvk371NLEAVETLGS TSVICSDK  388tgtl()
9395.1-3.03.091922.9381.3872cvvk371NLEAVETLGS TSVICSDK  388tgtl()
9244.1-2.52.811922.938-0.1622cvvk371NLEAVETLGS TSVICSDK  388tgtl()
9268.1-6.42.621329.7620.6772vpkr457IVIGDASETA LLK  469fsel()
9205.1-6.02.931329.7620.6302vpkr457IVIGDASETA LLK  469fsel()
9333.1-5.22.591329.7621.5312vpkr457IVIGDASETA LLK  469fsel()
9093.1-4.42.441370.6700.6462ilik536GQELPLDEQW R  546eafq()
9162.1-2.82.441370.6700.9362ilik536GQELPLDEQW R  546eafq()
9027.1-2.22.521370.6700.6072ilik536GQELPLDEQW R  546eafq()
10960.1-7.52.731374.6570.9082mqlk683DMDPSELVEA LR  694thpe()
9095.1-6.83.061796.9752.7722scqr719LGAIVAVTGD GVNDSPALK  737kadi()
9129.1-6.53.011796.9750.6182scqr719LGAIVAVTGD GVNDSPALK  737kadi()
9197.1-5.33.011797.960-0.3242scqr719LGAIVAVTGD GVNDSPALK  737kadi()
9024.1-3.52.931796.9750.8072scqr719LGAIVAVTGD GVNDSPALK  737kadi()
8849.1-6.43.111446.7261.9812alkk739ADIGVAMGIA GSDAAK  754naad()

 Protein Information

press if the information below appears incomplete
ENSEMBL Protein report: ENSP00000262623

Description: ATPase, H+/K+ exchanging, alpha polypeptide [Source:HGNC Symbol;Acc:819]

Location
Chromosome 19: 36,041,096-36,054,560 reverse strand.
Gene
This transcript is a product of gene ENSG00000105675 - There is 1 transcript in this gene
Name Transcript ID Length (bp) Protein ID Length (aa) Biotype CCDS
ATP4A-001 ENST00000262623 3558 ENSP00000262623 1035 Protein codingA protein coding transcript is a spliced mRNA that leads to a protein product.CCDS12467
Protein Sequence:

BLAST this sequence

Key

MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKRARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLARALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPYTRSP
ECTHESPLETRNIAFFSTMCLEGTRQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHMWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSKHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVESMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMWLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPYIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY
Domains
Domain type Start End Description Accession InterPro
Superfamily 51 1027 - 81665 -
Pfam 146 377 ATPase_P-typ_ATPase-assoc-dom PF00122 IPR008250 [Display all genes with this domain]
Prints 610 628 ATPase_P-typ_H-transp PR00120 IPR000695 [Display all genes with this domain]
Prints 758 783 ATPase_P-typ_H-transp PR00120 IPR000695 [Display all genes with this domain]
Pfam 2 43 ATPase_P-typ_H/K-transp_N PF09040 IPR015127 [Display all genes with this domain]
Prosite_patterns 387 393 ATPase_P-typ_P_site PS00154 IPR018303 [Display all genes with this domain]
TIGRfam 38 1035 ATPase_P-typ_cation-ex_asu_euk TIGR01106 IPR005775 [Display all genes with this domain]
Prints 114 128 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 141 161 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 305 327 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 378 399 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 516 534 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 798 819 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 865 885 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 927 947 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Prints 962 986 ATPase_P-typ_cation-exchng_asu PR00121 IPR006069 [Display all genes with this domain]
Pfam 845 1024 ATPase_P-typ_cation-transptr_C PF00689 IPR006068 [Display all genes with this domain]
Pfam 44 127 ATPase_P-typ_cation-transptr_N PF00690 IPR004014 [Display all genes with this domain]
TIGRfam 146 238 ATPase_P-typ_ion-transptr TIGR01494 IPR001757 [Display all genes with this domain]
Prints 225 239 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
TIGRfam 291 415 ATPase_P-typ_ion-transptr TIGR01494 IPR001757 [Display all genes with this domain]
Prints 385 399 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
TIGRfam 595 645 ATPase_P-typ_ion-transptr TIGR01494 IPR001757 [Display all genes with this domain]
Prints 598 609 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
Prints 620 630 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
TIGRfam 700 819 ATPase_P-typ_ion-transptr TIGR01494 IPR001757 [Display all genes with this domain]
Prints 726 745 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
Prints 750 762 ATPase_P-typ_ion-transptr PR00119 IPR001757 [Display all genes with this domain]
Pfam 381 749 Dehalogen-like_hydro PF00702 IPR005834 [Display all genes with this domain]
Other features
Feature type Start End
Coiled coil 43 65
Low complexity 19 51
Low complexity 74 84
Low complexity 143 153
Transmembrane 109 131
Transmembrane 141 160
Transmembrane 306 328
Transmembrane 333 355
Transmembrane 801 823
Transmembrane 923 945
Transmembrane 965 986
Transmembrane 996 1013
Residue Variation ID Variation type Alleles Ambiguity code Alternate residues
103 rs10422358 Synonymous G/A R -
145 rs60726757 Synonymous G/A R -
236 rs1047217 Synonymous C/T Y -
265 rs2733743 Non-synonymous A/G R A, V
402 rs2854923 Synonymous C/A M -
503 rs2230181 Synonymous G/T K -
586 rs61742920 Non-synonymous G/C S A, G
680 rs61729956 Non-synonymous T/A W Q, L
988 rs28581880 Non-synonymous T/C Y D, N

This transcript corresponds to the following database identifiers:

HGNC Symbol:
ATP4A
ATPase, H+/K+ exchanging, alpha polypeptide [view all locations]
UCSC Stable ID:
uc002oal.1 [view all locations]
CCDS:
CCDS12467.1 [view all locations]
WikiGene:
ATP4A
ATPase, H+/K+ exchanging, alpha polypeptide [view all locations]
UniProtKB/Swiss-Prot:
ATP4A_HUMAN [align]
Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)(Proton pump)(Gastric H(+)/K(+) ATPase subunit alpha) [view all locations]
RefSeq peptide:
NP_000695.2 [Target %id: 100; Query %id: 100] [align]
hydrogen/potassium-exchanging ATPase 4A [view all locations]
RefSeq DNA:
NM_000704.2 [align]
ATPase, H+/K+ exchanging, alpha polypeptide (ATP4A), mRNA [view all locations]
UniProtKB/TrEMBL:
Q53FM3_HUMAN [Target %id: 99; Query %id: 99] [align]
ATPase, H+/K+ exchanging, alpha polypeptide variant Fragment [view all locations]
Q658V6_HUMAN [Target %id: 96; Query %id: 99] [align]
Putative uncharacterized protein DKFZp666G172 Fragment [view all locations]
EntrezGene:
ATP4A
ATPase, H+/K+ exchanging, alpha polypeptide [view all locations]
EMBL:
AC002389 [align] [view all locations]
AD000090 [align] [view all locations]
AK223259 [align] [view all locations]
AL832971 [align] [view all locations]
J05451 [align] [view all locations]
M27575 [align] [view all locations]
M63962 [align] [view all locations]
HGNC (curated):
ATP4A-001 [view all locations]
IPI:
IPI00218919.7 [Target %id: 100; Query %id: 100]
Gene_Symbol=ATP4A Potassium-transporting ATPase alpha chain 1 [view all locations]
MIM gene:
137216
ATPase, H+,K+ EXCHANGING, ALPHA SUBUNIT [view all locations]
Protein ID:
AAA35577.1 [align] [view all locations]
AAA35988.1 [align] [view all locations]
AAA51010.1 [align] [view all locations]
AAB50172.1 [align] [view all locations]
AAB64182.1 [align] [view all locations]
BAD96979.1 [align] [view all locations]
CAH56338.1 [align] [view all locations]
UniGene:
Hs.36992 [Target %id: 96; Query %id: 95]
ATPase, H+/K+ exchanging, alpha polypeptide [view all locations]
Contributor: Dave Tabb
project comment Data transfer from Tranche. Published in Am J Physiol Gastrointest Liver Physiol. 2007 May;292(5):G1249-62. PMID: 17255364.
project VUMC Goldenring LTQ RPLC analysis of immunoisolated human gastric vesicles
BRENDA tissue BTO:0000502 
institution Vanderbilt University

Column notes.
  1. spectrum: written in the form "X.Y", where X is a unique identifier for a particular tandem mass spectrum in this data set and Y is an identifier for this particular sequence solution.
  2. log(e): the base-10 log of the expectation that any particular peptide assignment was made at random (E-value).
  3. log(I): the base-10 log of the sum of the fragment ion intensities in the tandem mass spectrum used to make this assignment.
  4. m+h: the calculated mass of the protonated parent ion for this sequence assignment.
  5. delta: the difference between the measured and calculated protonated parent ion masses.
  6. z: the charge of the parent ion measured.
  7. sequence: the sequence of the assigned peptide sequence. The sequences immediately N-terminal and C-terminal to the assigned peptide in the protein sequence are also shown.
  8. n: the number of observations of this peptide sequence in GPMDB.
  9. ω: the frequency of observation for this peptide in this protein (only available for some species).
Display modes:
  1. best: the peptide assignment with the best expectation value for a particular sequence and parent ion charge is shown.
  2. all: all peptide assignments are shown.
  3. modified: all peptide assignments that have at least one modified residue are shown.
  4. homologues: all peptides assignments unique to this protein sequence are shown.


protein.pl, v. 2010.09.03